PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 196aa    MW: 21255 Da    PI: 7.8063
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882603.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.43.5e-4514112199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  XP_015882603.1  14 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKELD 108
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_015882603.1 109 AANA 112
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.85213114IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4414111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
KLISFASSSS YNSPCAACKF LRRKCMPGCI FAPYFPPEEP QKFANVHKIF GASNVTKLLN  60
ELLPHQREDA VNSLAYEAEA RVRDPVYGCV GAISFLQRQV QRLQKELDAA NADLIRFACN  120
EIPTPAALPP PQPLMAPRHR PLEYGGGRRL GNEGGGAGFY SNSANFSLPY PLQWSTDHNP  180
SGDINEGSGG GGDGNM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882603.11e-144PREDICTED: protein LATERAL ORGAN BOUNDARIES-like, partial
SwissprotQ9FML42e-73LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD51e-99A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0015s09370.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-75LBD family protein